PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0213s0310.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 344aa    MW: 38131.9 Da    PI: 5.1753
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0213s0310.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.12.5e-2125475128
                     NAM  75 nratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             nrat +gyWkatgkd+e+ + +++l  +kktLvf++grap g++t+Wvmheyrl
  SapurV1A.0213s0310.2.p   2 NRATGKGYWKATGKDREIRR-QSQLLAMKKTLVFHSGRAPVGTRTNWVMHEYRL 54 
                             8******************9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100530.075178IPR003441NAC domain
SuperFamilySSF1019411.07E-25279IPR003441NAC domain
PfamPF023657.7E-10254IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MNRATGKGYW KATGKDREIR RQSQLLAMKK TLVFHSGRAP VGTRTNWVMH EYRLIDEDLE  60
RTGAMQIDSY VLCRVFHKNN IGPPTGNRYA PFIEEEWDDC GAALIPGEDA AADEVVVTHD  120
TGGEMHRTEQ DSHSINKSPL GITEVPGDSQ NALPVCKTES VEDCPPLCVL NTEAPLPLLQ  180
YKRRKHNNDT GSIRSNASEN STRTSQDPCS STTTTAATTS AEMMMATTSA TTTAISALLE  240
FSLMEPLEPK ENPRAPPPAL DAASLDSSMS PSCRKFINDL QSEIHKISVE RETLKLEVMS  300
AHTMINILQS RIDFLNKENE DLKRIDFLNK ENEDLKRSVP SEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-2328093170NAC domain-containing protein 19
3swp_C1e-2328093170NAC domain-containing protein 19
3swp_B1e-2328093170NAC domain-containing protein 19
3swp_A1e-2328093170NAC domain-containing protein 19
3swm_D1e-2328093170NAC domain-containing protein 19
3swm_C1e-2328093170NAC domain-containing protein 19
3swm_B1e-2328093170NAC domain-containing protein 19
3swm_A1e-2328093170NAC domain-containing protein 19
4dul_B1e-2328090167NAC domain-containing protein 19
4dul_A1e-2328090167NAC domain-containing protein 19
1ut7_B1e-2328090167NO APICAL MERISTEM PROTEIN
1ut7_A1e-2328090167NO APICAL MERISTEM PROTEIN
1ut4_B1e-2328090167NO APICAL MERISTEM PROTEIN
1ut4_A1e-2328090167NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1453940.0EF145394.1 Populus trichocarpa clone WS01124_C05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024336.10.0PREDICTED: NAC transcription factor NAM-A1
TrEMBLA9PB020.0A9PB02_POPTR; No apical meristem family protein
STRINGPOPTR_0010s23630.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-92NAC domain containing protein 50